PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P04340_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24504.1 Da    PI: 9.1287
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P04340_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF961.6e-301059251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           rien   rqvtfskRrng+lKKA+ELSvLCdaevavi+fs++gklye+ss
  GSMUA_Achr2P04340_001 10 RIENAASRQVTFSKRRNGLLKKAYELSVLCDAEVAVIVFSPRGKLYEFSS 59
                           8***********************************************96 PP

2K-box75.41.5e-25831701097
                  K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                            ++++++++  e++ + k+ie ++ ++R+llG++Les+slkeL +Le q+e+sl kiR +K+ +l+eqi +l+ k + l een +L+++
  GSMUA_Achr2P04340_001  83 TDSDMQQWISEATDIAKKIEVIEAQKRKLLGDGLESCSLKELCELEAQMERSLHKIRGRKQYVLTEQIAQLKDKVRVLLEENVKLHRE 170
                            68899********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.707161IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.52E-41375No hitNo description
SuperFamilySSF554553.27E-32374IPR002100Transcription factor, MADS-box
PfamPF003195.5E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.1E-2585170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.35687183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MVRGKTEMRR IENAASRQVT FSKRRNGLLK KAYELSVLCD AEVAVIVFSP RGKLYEFSSS  60
SVERTIDRYK MHTKDANIMD KGTDSDMQQW ISEATDIAKK IEVIEAQKRK LLGDGLESCS  120
LKELCELEAQ MERSLHKIRG RKQYVLTEQI AQLKDKVRVL LEENVKLHRE RHIEPQLQLA  180
STRDVGPKNH GNQEITEVET ELVIGRPGIR EDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-18169169Myocyte-specific enhancer factor 2B
1tqe_Q8e-18169169Myocyte-specific enhancer factor 2B
1tqe_R8e-18169169Myocyte-specific enhancer factor 2B
1tqe_S8e-18169169Myocyte-specific enhancer factor 2B
3mu6_A5e-18372271Myocyte-specific enhancer factor 2A
3mu6_B5e-18372271Myocyte-specific enhancer factor 2A
3mu6_C5e-18372271Myocyte-specific enhancer factor 2A
3mu6_D5e-18372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2445892e-98EU244589.1 Musa acuminata cultivar Mas SOC1-like protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384267.11e-156PREDICTED: MADS-box transcription factor 50-like isoform X1
RefseqXP_009384275.11e-156PREDICTED: MADS-box transcription factor 50-like isoform X1
SwissprotQ9XJ602e-70MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0S5251e-156M0S525_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04340_0011e-156(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.37e-64AGAMOUS-like 42